PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN00798.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 327aa    MW: 37637.1 Da    PI: 7.4186
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN00798.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.85.1e-5451331128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPt+eelv +yLk+k+++ k++l +vi e+d+yk+ePwd++      +++++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+v+s k
  KHN00798.1   5 VPPGFRFHPTEEELVGYYLKRKINSLKIDL-DVIVEIDLYKMEPWDIQDrckLGYEQQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAVMS-K 101
                 69****************************.99**************952432234677**************************************.8 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 ++ +g++ktLvfykgrap+g+ktdW+mheyr 
  KHN00798.1 102 NRIIGMRKTLVFYKGRAPNGRKTDWIMHEYRH 133
                 999***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.07E-593154IPR003441NAC domain
PROSITE profilePS5100557.3885154IPR003441NAC domain
PfamPF023653.1E-286132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MESCVPPGFR FHPTEEELVG YYLKRKINSL KIDLDVIVEI DLYKMEPWDI QDRCKLGYEQ  60
QNEWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKAVMS KNRIIGMRKT LVFYKGRAPN  120
GRKTDWIMHE YRHQTSEHGP PQAKGWVVCR AFRKPSPSHR QGFDPWCSTS SQQQHFFRDQ  180
IQSYARPLSI ADILNETNNV PHPVEGTSFS HSFNSDNQQH LNNIISNQTA IIMDKQLLEL  240
PQLDSPTASL AIKECNQQQH NGLTNEEYCS DERSNSSAQG IDWKSFDNLF GSQLSDNAAY  300
FSHPNLPLVM PHNHDQASHI LGCFPDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-49516017171NAC domain-containing protein 19
4dul_A5e-49516017171NAC domain-containing protein 19
1ut7_B5e-49516017171NO APICAL MERISTEM PROTEIN
1ut7_A5e-49516017171NO APICAL MERISTEM PROTEIN
1ut4_B5e-49516017171NO APICAL MERISTEM PROTEIN
1ut4_A5e-49516017171NO APICAL MERISTEM PROTEIN
3swp_D5e-49516020174NAC domain-containing protein 19
3swp_C5e-49516020174NAC domain-containing protein 19
3swp_B5e-49516020174NAC domain-containing protein 19
3swp_A5e-49516020174NAC domain-containing protein 19
3swm_D5e-49516020174NAC domain-containing protein 19
3swm_C5e-49516020174NAC domain-containing protein 19
3swm_B5e-49516020174NAC domain-containing protein 19
3swm_A5e-49516020174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-118AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006606215.10.0PREDICTED: NAC domain-containing protein 30-like
SwissprotQ9C8W91e-116NAC30_ARATH; NAC domain-containing protein 30
TrEMBLA0A0B2NZZ10.0A0A0B2NZZ1_GLYSO; NAC domain-containing protein 7
STRINGGLYMA20G31551.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-107vascular related NAC-domain protein 7
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]